Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Callithrix jacchus C-X-C chemokine receptor type 4 (CXCR4)

This Recombinant Callithrix jacchus C-X-C chemokine receptor type 4 (CXCR4) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 4, CXC-R4, CXCR-4, CD_antigen= CD184

UniProt

Q8HZU1

Expression Region

1-352

Origin

Callithrix jacchus (White-tufted-ear marmoset)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGISIYTSDNYTEEIGSGDYDSIKEPCFREENAHFNRIFLPTIYSIIFLTGIVGNGLVI LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGKFLCKAVHVIYTVNL YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT TVILILAFFACWLPYYIGISIDSFILLEIIRQGCEFENTVHKWISITEALAFFHCCLNPI LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL
BNC680449-500 1x 500 µL

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-500 1x 500 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-100 1x 100 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-100 1x 100 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), 1mg/mL
BNUM0851-50 1x 50 µL

HSP60 (LK1), 1mg/mL

Sign In for Pricing
View Details