Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anguilla anguilla Rhodopsin, deep-sea form

This Recombinant Anguilla anguilla Rhodopsin, deep-sea form spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Rhodopsin, deep-sea form

UniProt

Q90214

Expression Region

1-352

Origin

Anguilla anguilla (European freshwater eel) (Muraena anguilla)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYIPMSNITGVVRSPFEYPQYYLAEPWAYTILAAYMFTLILLGFPVNFLTLY VTIEHKKLRTPLNYILLNLAVANLFMVFGGFTTTVYTSMHGYFVFGETGCNLEGYFATLG GEISLWSLVVLAIERWVVVCKPMSNFRFGENHAIMGLAFTWIMANSCAMPPLFGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFIVHFSVPLTIISFCYGRLVCTVKEAAAQQQES ETTQRAEREVTRMVVIMVIAFLVCWVPYASVAWYIFTHQGSTFGPVFMTVPSFFAKSSAI YNPLIYICLNSQFRNCMITTLFCGKNPFQEEEGASTTASKTEASSVSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-500 1x 500 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF405M conjugate, 0.1mg/mL
BNC050200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF740 conjugate, 0.1mg/mL
BNC742313-500 1x 500 µL

Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Membrane (AE-5), CF640R conjugate, 0.1mg/mL
BNC400867-100 1x 100 µL

Nuclear Membrane (AE-5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF594 conjugate, 0.1mg/mL
BNC941571-500 1x 500 µL

GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF568 conjugate, 0.1mg/mL
BNC681989-500 1x 500 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details