Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Theropithecus gelada C-C chemokine receptor type 5 (CCR5)

This Recombinant Theropithecus gelada C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q95NC1

Expression Region

1-352

Origin

Theropithecus gelada (Gelada baboon)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKINVKQIAGRLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filaggrin (FLG) Human Gene Knockout Kit (CRISPR)
KN219792BN 1 Kit

Filaggrin (FLG) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ErbB 3 (ERBB3) Mouse Monoclonal Antibody [Clone ID: 3F10F6]
AM06263SU-N 100 µL

ErbB 3 (ERBB3) Mouse Monoclonal Antibody [Clone ID: 3F10F6]

Sign In for Pricing
View Details
EASYStep Pro Human D-Dimer (D2D) ELISA Kit
RDEp-D2D-Hu 96 Tests

EASYStep Pro Human D-Dimer (D2D) ELISA Kit

Sign In for Pricing
View Details
TAS1R3 (N-term) Rabbit Polyclonal Antibody
AP54155PU-N 400 µL

TAS1R3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VKORC1 (NM_024006) Human Over-expression Lysate
LY402968 100 µg

VKORC1 (NM_024006) Human Over-expression Lysate

Sign In for Pricing
View Details
KMT5A (N-term) Mouse Monoclonal Antibody [Clone ID: 43AT890]
AM11038PU-N 400 µL

KMT5A (N-term) Mouse Monoclonal Antibody [Clone ID: 43AT890]

Sign In for Pricing
View Details