Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Theropithecus gelada C-C chemokine receptor type 5 (CCR5)

This Recombinant Theropithecus gelada C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q95NC1

Expression Region

1-352

Origin

Theropithecus gelada (Gelada baboon)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKINVKQIAGRLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS626751 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Calbindin (CALB1) Rabbit Polyclonal Antibody
24427 100 µL

Calbindin (CALB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/3134R), Biotin conjugate, 0.1mg/mL
BNCB3134-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/3134R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RB associated KRAB repressor (RBAK) Human Gene Knockout Kit (CRISPR)
KN424517 1 Kit

RB associated KRAB repressor (RBAK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MicroScript microRNA cDNA Synthesis Kit-12p
54415 12 Reactions

MicroScript microRNA cDNA Synthesis Kit-12p

Sign In for Pricing
View Details
CACNG2 Mouse Monoclonal Antibody [Clone ID: N245/1]
75-242 100 µL

CACNG2 Mouse Monoclonal Antibody [Clone ID: N245/1]

Sign In for Pricing
View Details