Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Miopithecus talapoin C-C chemokine receptor type 5 (CCR5)

This Recombinant Miopithecus talapoin C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q95NC3

Expression Region

1-352

Origin

Miopithecus talapoin (Angolan talapoin) (Cercopithecus talapoin)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCRLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSMGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Pyrazoleboronic Acid Pinacol Ester
TRC-P842200-2.5G 2.5 g

4-Pyrazoleboronic Acid Pinacol Ester

Sign In for Pricing
View Details
ICG Maleimide
187-AAT 1 mg

ICG Maleimide

Sign In for Pricing
View Details
CREM Antibody
8C10864-AAT 50 µg

CREM Antibody

Sign In for Pricing
View Details
Atp6v0d1 Mouse Gene Knockout Kit (CRISPR)
KN501812 1 Kit

Atp6v0d1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LENG1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]
TA503111AM 100 µL

LENG1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]

Sign In for Pricing
View Details
RNF19B Antibody
KC-2819-01 50 μL

RNF19B Antibody

Sign In for Pricing
View Details