Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Miopithecus talapoin C-C chemokine receptor type 5 (CCR5)

This Recombinant Miopithecus talapoin C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q95NC3

Expression Region

1-352

Origin

Miopithecus talapoin (Angolan talapoin) (Cercopithecus talapoin)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCRLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSMGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Hexanoic Acid
TRC-H292145-250G 250 g

1-Hexanoic Acid

Sign In for Pricing
View Details
IL23 (IL23A) Mouse Monoclonal Antibody [Clone ID: B-Z23]
AM31213AF-N 500 µg

IL23 (IL23A) Mouse Monoclonal Antibody [Clone ID: B-Z23]

Sign In for Pricing
View Details
Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF568 conjugate, 0.1mg/mL
BNC682659-500 1x 500 µL

Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNA Ligase 1 (1A9), CF640R conjugate, 0.1mg/mL
BNC402177-500 1x 500 µL

DNA Ligase 1 (1A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human OOSP4B activation kit by CRISPRa
GA119926 1 Kit

Human OOSP4B activation kit by CRISPRa

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF640R conjugate, 0.1mg/mL
BNC401424-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details