Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trachypithecus johnii C-C chemokine receptor type 5 (CCR5)

This Recombinant Trachypithecus johnii C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q95NC6

Expression Region

1-352

Origin

Trachypithecus johnii (Nilgiri langur) (Semnopithecus johnii)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRSEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKHFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Liver Arginase Rabbit Monoclonal Antibody
AMRe86827-01 1 Each

Liver Arginase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Liver Arginase Rabbit Monoclonal Antibody
AMRe86827-02 50 µL

Liver Arginase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Liver Arginase Rabbit Monoclonal Antibody
AMRe86827-03 100 µL

Liver Arginase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Synaptophysin (BSA & Azide Free) (MaxLight 490)
MBS6501905-01 0.1 mL

Synaptophysin (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
Synaptophysin (BSA & Azide Free) (MaxLight 490)
MBS6501905-02 5x 0.1 mL

Synaptophysin (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
InVivoMAb Anti-Influenza A virus Neuraminidase/NA Antibody (1E01#)
MBS1579835-01 0.1 mg

InVivoMAb Anti-Influenza A virus Neuraminidase/NA Antibody (1E01#)

Sign In for Pricing
View Details