Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trachypithecus johnii C-C chemokine receptor type 5 (CCR5)

This Recombinant Trachypithecus johnii C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q95NC6

Expression Region

1-352

Origin

Trachypithecus johnii (Nilgiri langur) (Semnopithecus johnii)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRSEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKHFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC498460 sgRNA CRISPR Lentivector set (Rat)
K6004701 3x 1.0 µg

LOC498460 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Sostdc1 Mouse Gene Knockout Kit (CRISPR)
KN516481 1 Kit

Sostdc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Polyhexamethylene Biguanide Hydrochloride, 20% solution
286615-01 25 g

Polyhexamethylene Biguanide Hydrochloride, 20% solution

Sign In for Pricing
View Details
Polyhexamethylene Biguanide Hydrochloride, 20% solution
286615-02 100 g

Polyhexamethylene Biguanide Hydrochloride, 20% solution

Sign In for Pricing
View Details
Polyhexamethylene Biguanide Hydrochloride, 20% solution
286615-03 500 g

Polyhexamethylene Biguanide Hydrochloride, 20% solution

Sign In for Pricing
View Details
Polyhexamethylene Biguanide Hydrochloride, 20% solution
286615-04 1 Kg

Polyhexamethylene Biguanide Hydrochloride, 20% solution

Sign In for Pricing
View Details