Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorocebus aethiops B1 bradykinin receptor (BDKRB1)

This Recombinant Chlorocebus aethiops B1 bradykinin receptor (BDKRB1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

B1 bradykinin receptor, B1R, BK-1 receptor

UniProt

Q95L01

Expression Region

1-352

Origin

Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICSFGLLGNLFVLLV FLLPRRRLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRGINGVIKANL FISIFLVVAISQDRYCLLVHPMASRRRQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQAV PDLNITACILLLPHEAWHFARIVELNILAFLLPLAAIVFFNYHILASLRGREEVSRTRCG GRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAIRGCFWEDFIDLGLQLANFLA FTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tenascin (T2H5), CF488A conjugate, 0.1mg/mL
BNC880392-100 1x 100 µL

Tenascin (T2H5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF594 conjugate, 0.1mg/mL
BNC941365-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF700 conjugate, 0.1mg/mL
BNC000904-500 1x 500 µL

CD34 (QBEnd/10 + HPCA1/763), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/1198), CF568 conjugate, 0.1mg/mL
BNC681198-100 1x 100 µL

Cytokeratin 7 (KRT7/1198), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF594 conjugate, 0.1mg/mL
BNC942868-100 1x 100 µL

Serum Amyloid A (SAA/2868R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details