Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus solatus C-C chemokine receptor type 5 (CCR5)

This Recombinant Cercopithecus solatus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q9BGN6

Expression Region

1-352

Origin

Cercopithecus solatus (Sun-tailed monkey)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTIPFWAHYAAAQWDFGNTMCQLLTGLYLIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGLVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPSSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHLAKRFCKCCSISQQEAPERASSVYTRSTGEQETTVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhodopseudomonas palustris Probable multidrug resistance protein norM (norM), partial
MBS7089060 Inquire

Recombinant Rhodopseudomonas palustris Probable multidrug resistance protein norM (norM), partial

Sign In for Pricing
View Details
Rho GTPase Activating Protein 5 (ARHGAP5) Antibody
abx002596-01 20 µL

Rho GTPase Activating Protein 5 (ARHGAP5) Antibody

Sign In for Pricing
View Details
Rho GTPase Activating Protein 5 (ARHGAP5) Antibody
abx002596-02 100 µL

Rho GTPase Activating Protein 5 (ARHGAP5) Antibody

Sign In for Pricing
View Details
Rho GTPase Activating Protein 5 (ARHGAP5) Antibody
abx002596-03 2x 100 µL

Rho GTPase Activating Protein 5 (ARHGAP5) Antibody

Sign In for Pricing
View Details
PECMV-Gm4984-m-FLAG
BZ16282 1 Vial

PECMV-Gm4984-m-FLAG

Sign In for Pricing
View Details
G1P3 Double Nickase Plasmid (h)
sc-403682-NIC 20 µg

G1P3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details