Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus solatus C-C chemokine receptor type 5 (CCR5)

This Recombinant Cercopithecus solatus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q9BGN6

Expression Region

1-352

Origin

Cercopithecus solatus (Sun-tailed monkey)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTIPFWAHYAAAQWDFGNTMCQLLTGLYLIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGLVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPSSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHLAKRFCKCCSISQQEAPERASSVYTRSTGEQETTVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BID (I72) polyclonal antibody
BS1819 50ul

BID (I72) polyclonal antibody

Sign In for Pricing
View Details
Human CCDC88B Pre-designed siRNA Set A
SI002411A 1 Each

Human CCDC88B Pre-designed siRNA Set A

Sign In for Pricing
View Details
ZAP70 (Ab-292) Antibody
orb76561-01 50 μL

ZAP70 (Ab-292) Antibody

Sign In for Pricing
View Details
ZAP70 (Ab-292) Antibody
orb76561-02 100 µL

ZAP70 (Ab-292) Antibody

Sign In for Pricing
View Details
LCK, NT (Tyrosine-protein Kinase Lck, Proto-oncogene LCK, Lymphocyte Cell-specific Protein-tyrosine Kinase, p56-LCK, LSK, T Cell-specific Protein-tyrosine Kinase) (MaxLight 405) discontinued
L1565-05D-ML405 100 µL

LCK, NT (Tyrosine-protein Kinase Lck, Proto-oncogene LCK, Lymphocyte Cell-specific Protein-tyrosine Kinase, p56-LCK, LSK, T Cell-specific Protein-tyrosine Kinase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CSMD3 Polyclonal Antibody, PerCP Conjugated
bs-8190R-PerCP 100 µL

CSMD3 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details