Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus ascanius C-C chemokine receptor type 5 (CCR5)

This Recombinant Cercopithecus ascanius C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q9TV48

Expression Region

1-352

Origin

Cercopithecus ascanius (Black-cheeked white-nosed monkey) (Redtail monkey)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPRIIFTTSHRERLHYTCSS HFPYSQYQFWKNFHTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Contactin 3 (CNTN3) Human Gene Knockout Kit (CRISPR)
KN421979 1 Kit

Contactin 3 (CNTN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SARS-CoV-2 Nucleoprotein Antibody
KC-452-01 50 μL

SARS-CoV-2 Nucleoprotein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Nucleoprotein Antibody
KC-452-02 100 µL

SARS-CoV-2 Nucleoprotein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Nucleoprotein Antibody
KC-452-03 1 mL

SARS-CoV-2 Nucleoprotein Antibody

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (rTYMS/1884), Biotin conjugate, 0.1mg/mL
BNCB3812-500 1x 500 µL

Thymidylate Synthase (5-FU Resistance Marker) (rTYMS/1884), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL 18 Human, His
OM296680-01 10 µg

IL 18 Human, His

Sign In for Pricing
View Details