Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus cephus C-C chemokine receptor type 5 (CCR5)

This Recombinant Cercopithecus cephus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q9TV47

Expression Region

1-352

Origin

Cercopithecus cephus (Moustached monkey)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYNTSEPCQKINVKQIAARLLPLLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPRIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-rno-miR-203a-3p Vector
mr40635 500 ng

LentimiRa-rno-miR-203a-3p Vector

Sign In for Pricing
View Details
CXCR5 Recombinant Rabbit mAb, PE conjugated
orb2348500 100 µL

CXCR5 Recombinant Rabbit mAb, PE conjugated

Sign In for Pricing
View Details
YAP1 polyclonal antibody
orb1677918-01 50 µL

YAP1 polyclonal antibody

Sign In for Pricing
View Details
YAP1 polyclonal antibody
orb1677918-02 100 µL

YAP1 polyclonal antibody

Sign In for Pricing
View Details
YAP1 polyclonal antibody
orb1677918-03 200 µL

YAP1 polyclonal antibody

Sign In for Pricing
View Details
Rabbit Glucagon (GC) ELISA Kit
CSB-E16297Rb-01 24 Well

Rabbit Glucagon (GC) ELISA Kit

Sign In for Pricing
View Details