Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus cephus C-C chemokine receptor type 5 (CCR5)

This Recombinant Cercopithecus cephus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q9TV47

Expression Region

1-352

Origin

Cercopithecus cephus (Moustached monkey)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYNTSEPCQKINVKQIAARLLPLLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPRIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 Peptide
AF6961-BP 1 mg

AKT1 Peptide

Sign In for Pricing
View Details
Lentiviral human C9orf24 shRNA (UAS) - Lentiviral human C9orf24 shRNA (UAS, RFP) (100)
GTR15081432 1 Vial

Lentiviral human C9orf24 shRNA (UAS) - Lentiviral human C9orf24 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Pipette tips, 1-200 uL, Racked, Yellow , DNase/RNase free - 10 x 96 un. - ABDOS
P10140 10x 96 Units/Pack

Pipette tips, 1-200 uL, Racked, Yellow , DNase/RNase free - 10 x 96 un. - ABDOS

Sign In for Pricing
View Details
Insulin Like Growth Factor 2 (IGF2) Human ELISA Kit
E2838 96 Tests

Insulin Like Growth Factor 2 (IGF2) Human ELISA Kit

Sign In for Pricing
View Details
ELMO3 (C) Antibody, Rabbit Polyclonal
orb386561 100 µL

ELMO3 (C) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Cysteine desulfuration protein sufE (sufE)
MBS1119280-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O127:H6 Cysteine desulfuration protein sufE (sufE)

Sign In for Pricing
View Details