Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus sabaeus C-C chemokine receptor type 5 (CCR5)

This Recombinant Cercopithecus sabaeus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q9TV43

Expression Region

1-352

Origin

Cercopithecus sabaeus (Green monkey) (Chlorocebus sabaeus)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKIKVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPRIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNDKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQDAPERASSVYTRSTGEQETSVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DIS3L activation kit by CRISPRa
GA114544 1 Kit

Human DIS3L activation kit by CRISPRa

Sign In for Pricing
View Details
Asymmetric Di-Methyl Arginine (ADMA) Recombinant Rabbit monoclonal Antibody
HA751302 100 µL

Asymmetric Di-Methyl Arginine (ADMA) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS631936 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
RFC2 Rabbit Polyclonal Antibody
TA380863 100 µL

RFC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(+)-Lappaconitine >90%
TRC-L175850-250MG 250 mg

(+)-Lappaconitine >90%

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS714941 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details