Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus sabaeus C-C chemokine receptor type 5 (CCR5)

This Recombinant Cercopithecus sabaeus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q9TV43

Expression Region

1-352

Origin

Cercopithecus sabaeus (Green monkey) (Chlorocebus sabaeus)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKIKVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPRIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNDKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQDAPERASSVYTRSTGEQETSVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tuba1a Mouse Gene Knockout Kit (CRISPR)
KN318458BN 1 Kit

Tuba1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ces1g Mouse Gene Knockout Kit (CRISPR)
KN503193 1 Kit

Ces1g Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Kollisolv PEG 300
TRC-K655100-25G 25 g

Kollisolv PEG 300

Sign In for Pricing
View Details
RMND5A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D1]
TA803152AM 100 µL

RMND5A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D1]

Sign In for Pricing
View Details
Human Glutathione Reductase (GSR) activation kit by CRISPRa
GA101986 1 Kit

Human Glutathione Reductase (GSR) activation kit by CRISPRa

Sign In for Pricing
View Details
Acetovanillone-d3
TRC-A164092-10MG 10 mg

Acetovanillone-d3

Sign In for Pricing
View Details