Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus lhoesti C-C chemokine receptor type 5 (CCR5)

This Recombinant Cercopithecus lhoesti C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

Q9XT76

Expression Region

1-352

Origin

Cercopithecus lhoesti (L'Hoest's monkey)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTIPFWAHYAAAQWDFGNTMCQLLTGLYLIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGLVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPSSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHLAKRFCKCCSIFQQEAPERASSVYTRSTGEQETTVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arhgap21 Mouse Gene Knockout Kit (CRISPR)
KN501495 1 Kit

Arhgap21 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HABP2 (NM_004132) Human Over-expression Lysate
LC401333 20 µg

HABP2 (NM_004132) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant MRAS Antibody
RC-5808-01 50 μL

Recombinant MRAS Antibody

Sign In for Pricing
View Details
Recombinant MRAS Antibody
RC-5808-02 100 µL

Recombinant MRAS Antibody

Sign In for Pricing
View Details
Recombinant MRAS Antibody
RC-5808-03 1 mL

Recombinant MRAS Antibody

Sign In for Pricing
View Details
HADHSC (HADH) (NM_001184705) Human Over-expression Lysate
LY432896 100 µg

HADHSC (HADH) (NM_001184705) Human Over-expression Lysate

Sign In for Pricing
View Details