Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pomatoschistus minutus Rhodopsin (rho)

This Recombinant Pomatoschistus minutus Rhodopsin (rho) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P35403

Expression Region

1-352

Origin

Pomatoschistus minutus (Sand goby) (Gobius minutus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPFFYIPMVNTTGIVRSPYEYPQYYLVNPAAYAALGAYMFFLILTGFPINFLTLY VTLEHKKLRTALNLILLNLAVADLFMVFGGFTTTMYTSMHGYFVLGRLGCNVEGFFATLG GEIALWSLVVLAVERWVVVCKPISNFRFTENHAIMGVAFSWIMAATCAVPPLVGWSRYIP EGMQCSCGVDYYTRAEGFNNESFVIYMFIVHFLAPLIVIFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVIIMVIGFLTSWLPYASVAWYIFTHQGTEFGPLFMTIPAFFAKSSAL YNPMIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTKTEASSVSSSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-500 1x 500 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-100 1x 100 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799 + KRT19/800), CF568 conjugate, 0.1mg/mL
BNC681150-500 1x 500 µL

Cytokeratin 19 (KRT19/799 + KRT19/800), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1468), CF488A conjugate, 0.1mg/mL
BNC881468-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1468), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details