Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Semnopithecus entellus C-C chemokine receptor type 5 (CCR5)

This Recombinant Semnopithecus entellus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

P61757

Expression Region

1-352

Origin

Semnopithecus entellus (Hanuman langur) (Presbytis entellus)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hoxc11 Rabbit Polyclonal Antibody (FITC)
orb2128056 100 µL

Hoxc11 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Polynucleotide 5'-hydroxyl-kinase nol9 (nol9), partial
MBS1403384 Inquire

Recombinant Dictyostelium discoideum Polynucleotide 5'-hydroxyl-kinase nol9 (nol9), partial

Sign In for Pricing
View Details
BUB1B Protein Vector (Human) (pPB-His-GST)
PV327943 500 ng

BUB1B Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
SLC22A10 (NM_001039752) Human Untagged Clone
SC317919 10 µg

SLC22A10 (NM_001039752) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse H2-DMb2 shRNA (UAS) - Lentiviral mouse H2-DMb2 shRNA (UAS, iRFP) (100)
GTR15150603 1 Vial

Lentiviral mouse H2-DMb2 shRNA (UAS) - Lentiviral mouse H2-DMb2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)
MBS2007166-01 0.1 mL

Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)

Sign In for Pricing
View Details