Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Semnopithecus entellus C-C chemokine receptor type 5 (CCR5)

This Recombinant Semnopithecus entellus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

P61757

Expression Region

1-352

Origin

Semnopithecus entellus (Hanuman langur) (Presbytis entellus)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIRacle™ hsa-miR-520a-5p miRNA Agomir/Antagomir
AM1551 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-520a-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Recombinant Mouse Integrin alpha-L Protein, His, Yeast-100ug
QP6240-ye-100ug 100ug

Recombinant Mouse Integrin alpha-L Protein, His, Yeast-100ug

Sign In for Pricing
View Details
Sox12 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6079903 1.0 µg DNA

Sox12 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Chlorobium chlorochromatii Lipoprotein signal peptidase (lspA), partial
MBS7079095 Inquire

Recombinant Chlorobium chlorochromatii Lipoprotein signal peptidase (lspA), partial

Sign In for Pricing
View Details
Phospho-P53 (Thr55) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-5596R-BF594-TR 20 µL

Phospho-P53 (Thr55) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
COP (CARD16) (NM_052889) Human Recombinant Protein
TP311537L 1 mg

COP (CARD16) (NM_052889) Human Recombinant Protein

Sign In for Pricing
View Details