Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Semnopithecus entellus C-C chemokine receptor type 5 (CCR5)

This Recombinant Semnopithecus entellus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

P61757

Expression Region

1-352

Origin

Semnopithecus entellus (Hanuman langur) (Presbytis entellus)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRP6 Protein Vector (Rat) (pPB-C-His)
PV285442 500 ng

NLRP6 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
RASEF 3'UTR Luciferase Stable Cell Line
TU019536 1.0 mL

RASEF 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Complement Component 3c (C3c), Recombinant, Human, His-Tag
057821-01 10 µg

Complement Component 3c (C3c), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Complement Component 3c (C3c), Recombinant, Human, His-Tag
057821-02 50 µg

Complement Component 3c (C3c), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Complement Component 3c (C3c), Recombinant, Human, His-Tag
057821-03 100 µg

Complement Component 3c (C3c), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Complement Component 3c (C3c), Recombinant, Human, His-Tag
057821-04 200 µg

Complement Component 3c (C3c), Recombinant, Human, His-Tag

Sign In for Pricing
View Details