Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trachypithecus phayrei C-C chemokine receptor type 5 (CCR5)

This Recombinant Trachypithecus phayrei C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

O97879

Expression Region

1-352

Origin

Trachypithecus phayrei (Phayre's leaf monkey)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tartrate Resistant Acid Phosphatase (ACP5) (NM_001111034) Human Tagged Lenti ORF Clone
RC225470L3 10 µg

Tartrate Resistant Acid Phosphatase (ACP5) (NM_001111034) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Sell sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3340408 1.0 µg DNA

Sell sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
4930505A04Rik Protein Lysate (Mouse) with C-HA Tag
10648034 100 µg

4930505A04Rik Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Human Transglutaminase 1 (TGM1) ELISA Kit
EKU07829 96 Tests

Human Transglutaminase 1 (TGM1) ELISA Kit

Sign In for Pricing
View Details
Acap3 Mouse siRNA Oligo Duplex (Locus ID 140500)
SR420519 1 Kit

Acap3 Mouse siRNA Oligo Duplex (Locus ID 140500)

Sign In for Pricing
View Details
TRIM10 293 Cell Lysate
404967 0.1 mg

TRIM10 293 Cell Lysate

Sign In for Pricing
View Details