Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trachypithecus phayrei C-C chemokine receptor type 5 (CCR5)

This Recombinant Trachypithecus phayrei C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

O97879

Expression Region

1-352

Origin

Trachypithecus phayrei (Phayre's leaf monkey)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 840 Anti-human CD21 Antibody *HI21a*
102100Q0-AAT 100 Tests

IFluor® 840 Anti-human CD21 Antibody *HI21a*

Sign In for Pricing
View Details
RPS3P3 AAV siRNA Pooled Vector
42549161 1.0 µg

RPS3P3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
LOC147664 Recombinant Protein (Human)
RP040822 100 µg

LOC147664 Recombinant Protein (Human)

Sign In for Pricing
View Details
RN5S82 Protein Vector (Human) (pPB-N-His)
PV117939 500 ng

RN5S82 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PTPN6 Polyclonal Antibody
ANT-13997-50ug 50 µg

PTPN6 Polyclonal Antibody

Sign In for Pricing
View Details
OSTF1 Polyclonal Antibody
MBS9431510-01 0.05 mL

OSTF1 Polyclonal Antibody

Sign In for Pricing
View Details