Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trachypithecus phayrei C-C chemokine receptor type 5 (CCR5)

This Recombinant Trachypithecus phayrei C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

O97879

Expression Region

1-352

Origin

Trachypithecus phayrei (Phayre's leaf monkey)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Epidermal Growth Factor Receptor 2 (EGFR2) ELISA Kit
EIA07563Gu 1 Kit

Guinea pig Epidermal Growth Factor Receptor 2 (EGFR2) ELISA Kit

Sign In for Pricing
View Details
Chrna2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4116705 3x 1.0 µg

Chrna2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Inverted dA (reverse linkage) 5 umol scale
26-6551-06 1 Each

Inverted dA (reverse linkage) 5 umol scale

Sign In for Pricing
View Details
Anti-PAK2 (pS20) Antibody
MBS9239223-01 0.05 mL

Anti-PAK2 (pS20) Antibody

Sign In for Pricing
View Details
Anti-PAK2 (pS20) Antibody
MBS9239223-02 0.1 mL

Anti-PAK2 (pS20) Antibody

Sign In for Pricing
View Details
Anti-PAK2 (pS20) Antibody
MBS9239223-03 5x 0.1 mL

Anti-PAK2 (pS20) Antibody

Sign In for Pricing
View Details