Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhinopithecus avunculus C-C chemokine receptor type 5 (CCR5)

This Recombinant Rhinopithecus avunculus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

O97962

Expression Region

1-352

Origin

Rhinopithecus avunculus (Tonkin snub-nosed monkey) (Pygathrix avunculus)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGVHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQETSVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk1 / p34cdc2 Serine-Threonine Kinase (A17.1.1), CF488A conjugate, 0.1mg/mL
BNC881083-100 1x 100 µL

Cdk1 / p34cdc2 Serine-Threonine Kinase (A17.1.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyVolt™ Mini power supply, 115V
E2100 1 Each

MyVolt™ Mini power supply, 115V

Sign In for Pricing
View Details
Gamma-CEHC-d5
TRC-C249202-1MG 1 mg

Gamma-CEHC-d5

Sign In for Pricing
View Details
Diethyl Cromoglycate
TRC-D444130-250MG 250 mg

Diethyl Cromoglycate

Sign In for Pricing
View Details
RASSF8 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F7]
TA505906AM 100 µL

RASSF8 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F7]

Sign In for Pricing
View Details
Atp23 Mouse Gene Knockout Kit (CRISPR)
KN519526 1 Kit

Atp23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details