Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhinopithecus avunculus C-C chemokine receptor type 5 (CCR5)

This Recombinant Rhinopithecus avunculus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

O97962

Expression Region

1-352

Origin

Rhinopithecus avunculus (Tonkin snub-nosed monkey) (Pygathrix avunculus)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGVHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQETSVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TCblR/8D6A Protein (Fc Tag)
PKSH033134-01 10 µg

Recombinant Human TCblR/8D6A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human TCblR/8D6A Protein (Fc Tag)
PKSH033134-02 50 µg

Recombinant Human TCblR/8D6A Protein (Fc Tag)

Sign In for Pricing
View Details
Glipr2 (NM_027450) Mouse Tagged ORF Clone
MG201135 10 µg

Glipr2 (NM_027450) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
2,3,4,-Tri-O-benzyl-L-fucopyranose
TRC-T768000-250MG 250 mg

2,3,4,-Tri-O-benzyl-L-fucopyranose

Sign In for Pricing
View Details
Rho GTPase activating protein 29 (ARHGAP29) (NM_004815) Human Recombinant Protein
TP310830L 1 mg

Rho GTPase activating protein 29 (ARHGAP29) (NM_004815) Human Recombinant Protein

Sign In for Pricing
View Details
CCDC9 Human Gene Knockout Kit (CRISPR)
KN401107 1 Kit

CCDC9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details