Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhinopithecus avunculus C-C chemokine receptor type 5 (CCR5)

This Recombinant Rhinopithecus avunculus C-C chemokine receptor type 5 (CCR5) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CCR5, CD_antigen= CD195

UniProt

O97962

Expression Region

1-352

Origin

Rhinopithecus avunculus (Tonkin snub-nosed monkey) (Pygathrix avunculus)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGVHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQETSVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CYP4A22 activation kit by CRISPRa
GA117164 1 Kit

Human CYP4A22 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS502209 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
Cy5NS acid
194-AAT 100 mg

Cy5NS acid

Sign In for Pricing
View Details
1,3-Glyceryl Dilinoleate (>80%)
TRC-G601520-250MG 250 mg

1,3-Glyceryl Dilinoleate (>80%)

Sign In for Pricing
View Details
Purified Anti-Human CD185 Antibody[J252D4]
E-AB-F12870P-01 25 µg

Purified Anti-Human CD185 Antibody[J252D4]

Sign In for Pricing
View Details
Purified Anti-Human CD185 Antibody[J252D4]
E-AB-F12870P-02 100 µg

Purified Anti-Human CD185 Antibody[J252D4]

Sign In for Pricing
View Details