Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Putative permease perM (perM)

This Recombinant Escherichia coli Putative permease perM (perM) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Putative permease perM

UniProt

P0AFI9

Expression Region

1-353

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEMLMQWYRRRFSDPEAIALLVILVAGFGIIFFFSGLLAPLLVAIVLAYLLEWPTVRLQ SIGCSRRWATSIVLVVFVGILLLMAFVVLPIAWQQGIYLIRDMPGMLNKLSDFAATLPRR YPALMDAGIIDAMAENMRSRMLTMGDSVVKISLASLVGLLTIAVYLVLVPLMVFFLLKDK EQMLNAVRRVLPRNRGLAGQVWKEMNQQITNYIRGKVLEMIVVGIATWLGFLLFGLNYSL LLAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGAGTEFWSCFAVYLIIQALDGNLLVPVL FSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKAVIHAWPDGQIAQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7orf28A (Center) Rabbit pAb
E2611047 100 µL

C7orf28A (Center) Rabbit pAb

Sign In for Pricing
View Details
Fruit fly Sarm Rabbit Polyclonal Antibody (Fluoro550)
orb3088098 200 µL

Fruit fly Sarm Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
PRF1 (Perforin 1, FLH2, HPLH2, MGC65093, P1, PFN1, PFP) (MaxLight 750)
MBS6432819-01 0.1 mL

PRF1 (Perforin 1, FLH2, HPLH2, MGC65093, P1, PFN1, PFP) (MaxLight 750)

Sign In for Pricing
View Details
PRF1 (Perforin 1, FLH2, HPLH2, MGC65093, P1, PFN1, PFP) (MaxLight 750)
MBS6432819-02 5x 0.1 mL

PRF1 (Perforin 1, FLH2, HPLH2, MGC65093, P1, PFN1, PFP) (MaxLight 750)

Sign In for Pricing
View Details
Cellular Tumor Antigen p53 (TP53) Antibody (FITC)
abx446376 100 µg

Cellular Tumor Antigen p53 (TP53) Antibody (FITC)

Sign In for Pricing
View Details
Donkey anti-Rat IgG Heavy and Light Chain Antibody Biotinylated
A110-137B 1 mg

Donkey anti-Rat IgG Heavy and Light Chain Antibody Biotinylated

Sign In for Pricing
View Details