Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Putative permease perM (perM)

This Recombinant Escherichia coli Putative permease perM (perM) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Putative permease perM

UniProt

P0AFI9

Expression Region

1-353

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEMLMQWYRRRFSDPEAIALLVILVAGFGIIFFFSGLLAPLLVAIVLAYLLEWPTVRLQ SIGCSRRWATSIVLVVFVGILLLMAFVVLPIAWQQGIYLIRDMPGMLNKLSDFAATLPRR YPALMDAGIIDAMAENMRSRMLTMGDSVVKISLASLVGLLTIAVYLVLVPLMVFFLLKDK EQMLNAVRRVLPRNRGLAGQVWKEMNQQITNYIRGKVLEMIVVGIATWLGFLLFGLNYSL LLAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGAGTEFWSCFAVYLIIQALDGNLLVPVL FSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKAVIHAWPDGQIAQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Adenosylhomocysteinase (AHCY)
TRV-0051024-01 24 Tests

ELISA Kit for Adenosylhomocysteinase (AHCY)

Sign In for Pricing
View Details
ELISA Kit for Adenosylhomocysteinase (AHCY)
TRV-0051024-02 48 Tests

ELISA Kit for Adenosylhomocysteinase (AHCY)

Sign In for Pricing
View Details
ELISA Kit for Adenosylhomocysteinase (AHCY)
TRV-0051024-03 96 Tests

ELISA Kit for Adenosylhomocysteinase (AHCY)

Sign In for Pricing
View Details
ELISA Kit for Adenosylhomocysteinase (AHCY)
TRV-0051024-04 5x 96 Tests

ELISA Kit for Adenosylhomocysteinase (AHCY)

Sign In for Pricing
View Details
ELISA Kit for Adenosylhomocysteinase (AHCY)
TRV-0051024-05 10x 96 Tests

ELISA Kit for Adenosylhomocysteinase (AHCY)

Sign In for Pricing
View Details
Potassium tetraoxalate dihydrate 98%
P23960-01 500 g

Potassium tetraoxalate dihydrate 98%

Sign In for Pricing
View Details