Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chelon labrosus Rhodopsin (rho)

This Recombinant Chelon labrosus Rhodopsin (rho) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

Q9YGZ8

Expression Region

1-353

Origin

Chelon labrosus (Thicklip grey mullet) (Mugil chelo)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPYFYIPMVNTTGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILVGFPVNFLTLY VTLEHKKLRTPLNYILLNLAVADLFMVLGGFTTTMYTSMHGYFVLGRLGCNVEGFFATLG GEIALWSLVVLAIERWVVVCKPISNFRFSEDHAIMGLAFTWVMASACAVPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFVCHFLIPLVVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVSRMVVIMVVAFLVCWCPYAGVAWYIFTHQGSEFGPLFMTFPAFFAKSSSI YNPMIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTSKTEASSVSSSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-100 1x 100 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-500 1x 500 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF405S conjugate, 0.1mg/mL
BNC042076-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tenascin (T2H5), CF405S conjugate, 0.1mg/mL
BNC040392-100 1x 100 µL

Tenascin (T2H5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (C117/370), CF640R conjugate, 0.1mg/mL
BNC400370-100 1x 100 µL

CD117 (C117/370), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details