Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solea solea Rhodopsin (rho)

This Recombinant Solea solea Rhodopsin (rho) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

Q9YGZ5

Expression Region

1-353

Origin

Solea solea (Common sole)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPYFYIPMLNTTGIVRSPYEYPQYYLVNPAAYAALCAYMFLLILLGFPINFLTLY VTIEHKKLRTPLNYILLNLAVANLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIGLWSLVVLAVERWMVVCKPISNFRFTENHAIMGLGFTWFAASACAVPPLVGWSRYIP EGMQCSCGVDYYTRAEGFNNESFVVYMFVCHFLIPLIVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVVIMVIAFLICWCPYAGVAWYIFSNQGSEFGPLFMTIPAFFAKSSSI YNPLIYIFMNKQFRHCMITTLCCGKNPFEEEEGSTTTSKTEASSASSSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vaccum Pump BVAP-304
BVAP-304 1 Unit

Vaccum Pump BVAP-304

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF594 conjugate, 0.1mg/mL
BNC942266-500 1x 500 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PPIL5 (LRR1) activation kit by CRISPRa
GA114786 1 Kit

Human PPIL5 (LRR1) activation kit by CRISPRa

Sign In for Pricing
View Details
D-Xylulose 5-Phosphate Sodium Salt
TRC-X750920-25MG 25 mg

D-Xylulose 5-Phosphate Sodium Salt

Sign In for Pricing
View Details
Vps28 Mouse Gene Knockout Kit (CRISPR)
KN519249 1 Kit

Vps28 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NAPSIN A (NAPSA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G9]
TA807838AM 100 µL

NAPSIN A (NAPSA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G9]

Sign In for Pricing
View Details