Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solea solea Rhodopsin (rho)

This Recombinant Solea solea Rhodopsin (rho) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

Q9YGZ5

Expression Region

1-353

Origin

Solea solea (Common sole)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPYFYIPMLNTTGIVRSPYEYPQYYLVNPAAYAALCAYMFLLILLGFPINFLTLY VTIEHKKLRTPLNYILLNLAVANLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIGLWSLVVLAVERWMVVCKPISNFRFTENHAIMGLGFTWFAASACAVPPLVGWSRYIP EGMQCSCGVDYYTRAEGFNNESFVVYMFVCHFLIPLIVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVVIMVIAFLICWCPYAGVAWYIFSNQGSEFGPLFMTIPAFFAKSSSI YNPLIYIFMNKQFRHCMITTLCCGKNPFEEEEGSTTTSKTEASSASSSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CHMP2A (NM_014453) AAV Particle
RC200068A1V 250 µL

Human CHMP2A (NM_014453) AAV Particle

Sign In for Pricing
View Details
MTND4P27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV735204 1.0 µg DNA

MTND4P27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Rabbit Complement Factor B ELISA Kit
MBS028917-01 48 Well

Rabbit Complement Factor B ELISA Kit

Sign In for Pricing
View Details
Rabbit Complement Factor B ELISA Kit
MBS028917-02 96 Well

Rabbit Complement Factor B ELISA Kit

Sign In for Pricing
View Details
Rabbit Complement Factor B ELISA Kit
MBS028917-03 5x 96 Well

Rabbit Complement Factor B ELISA Kit

Sign In for Pricing
View Details
Rabbit Complement Factor B ELISA Kit
MBS028917-04 10x 96 Well

Rabbit Complement Factor B ELISA Kit

Sign In for Pricing
View Details