Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mugil cephalus Rhodopsin (rho)

This Recombinant Mugil cephalus Rhodopsin (rho) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

Q9YGZ9

Expression Region

1-353

Origin

Mugil cephalus (Flathead mullet) (Mugil japonicus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPYFYIPMVNTTGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILLGFPINFLTLY VTIEHKKLRTPLNYILLNLAVANLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIALWSLVVLAVERWMVVCKPISNFRFGENHAIMGLAFTWVMASACAVPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFVCHFLIPLVVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVSRMVVIMVVAFLICWCPYAGVAWYIFTHQGSEFGPLFMTFPAFFAKSSSI YNPMIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTSKTEASSVSSSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-100 1x 100 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-500 1x 500 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (MLP/842), CF647 conjugate, 0.1mg/mL
BNC470842-500 1x 500 µL

MUC2 (MLP/842), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details