Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sparus aurata Rhodopsin (rho)

This Recombinant Sparus aurata Rhodopsin (rho) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

Q9YH02

Expression Region

1-353

Origin

Sparus aurata (Gilthead sea bream)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPFFYVPMVNTSGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILVGFPINFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVLGRLGCNIEGFFATLG GEIALWSLVVLAIERWVVVCKPISNFRFGENHAIMGLAFTWIMAMACAAPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFICHFSIPLTIVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVIMMVIAFLVCWLPYAGVAWWIFTHQGSEFGPVFMTIPAFFAKSSSI YNPMIYICLNKQFRHCMITTLCCGKNPFEEEEGASTASKTEASSVSSSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-100 1x 100 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-100 1x 100 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (RT-97), CF647 conjugate, 0.1mg/mL
BNC470454-500 1x 500 µL

Neurofilament (NF-H) (RT-97), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF740 conjugate, 0.1mg/mL
BNC741388-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF594 conjugate, 0.1mg/mL
BNC942110-100 1x 100 µL

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (CNN1/832), CF640R conjugate, 0.1mg/mL
BNC400832-100 1x 100 µL

Calponin-1 (CNN1/832), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details