Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Diplodus annularis Rhodopsin (rho)

This Recombinant Diplodus annularis Rhodopsin (rho) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

Q9YH05

Expression Region

1-353

Origin

Diplodus annularis (Annular seabream) (Sparus annularis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPFFYVPMVNTTGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILVGFPINFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVLGGFTTTMYTSMHGYFVLGRLGCNIEGFFATLG GEIALWSLVVLAIERWVVVCKPISNFRFGENHAIMGLAFTWTMAMACAAPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFICHFTIPLTVVFFCYGRLLCAVKEAAAAQQES ETTQRAEKEVTRMVIMMVIAFLVCWLPYASVAWYIFTHQGSEFGPVFMTIPAFFAKSSSI YNPMIYICLNKQFRHCMITTLCCGKNPFEEEEGASTASKTEASSVSSSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (B33/20), CF640R conjugate, 0.1mg/mL
BNC400952-100 1x 100 µL

Human IgG Immunoglobulin (B33/20), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/515), CF488A conjugate, 0.1mg/mL
BNC880515-100 1x 100 µL

CD79a (IGA/515), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF405S conjugate, 0.1mg/mL
BNC040844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details