Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lithognathus mormyrus Rhodopsin (rho)

This Recombinant Lithognathus mormyrus Rhodopsin (rho) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

Q9YH00

Expression Region

1-353

Origin

Lithognathus mormyrus (Striped seabream) (Sparus mormyrus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPYFYVPMVNTSGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILVGFPINFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVLGRLGCNIEGFFATLG GEIALWSLVVLAIERWVVVCKPISNFRFGENHAIMGLAFTWLMAMACAAPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFVCHFLIPLMVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVVIMVIAFLICWCPYAGVAWWIFTHQGSDFGPVFMTIPAFFAKSSSI YNPMIYICLNKQFRHCMITTLCCGKNPFEEEEGASTASKTEASSVSSSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human B-Lymphocyte Chemoattractant 1 (BLC1) ELISA Kit
RDR-BLC1-Hu-01 96 Tests

Human B-Lymphocyte Chemoattractant 1 (BLC1) ELISA Kit

Sign In for Pricing
View Details
Human B-Lymphocyte Chemoattractant 1 (BLC1) ELISA Kit
RDR-BLC1-Hu-02 48 Tests

Human B-Lymphocyte Chemoattractant 1 (BLC1) ELISA Kit

Sign In for Pricing
View Details
Tissue Protein Lysate, Skin
CP609318 150 µg

Tissue Protein Lysate, Skin

Sign In for Pricing
View Details
(R)-Valiolamine Voglibose Dihydrochloride
TRC-V094390-1MG 1 mg

(R)-Valiolamine Voglibose Dihydrochloride

Sign In for Pricing
View Details
GSK3 alpha (GSK3A) Rabbit Monoclonal Antibody [Clone ID: R01-5G6]
TA384339 100 µL

GSK3 alpha (GSK3A) Rabbit Monoclonal Antibody [Clone ID: R01-5G6]

Sign In for Pricing
View Details
CD51 / Integrin V (ITGAV/1610), CF640R conjugate, 0.1mg/mL
BNC401610-100 1x 100 µL

CD51 / Integrin V (ITGAV/1610), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details