Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Melatonin receptor type 1A (Mtnr1a)

This Recombinant Mouse Melatonin receptor type 1A (Mtnr1a) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Melatonin receptor type 1A, Mel-1A-R, Mel1a receptor

UniProt

Q61184

Expression Region

1-353

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGNVSELLNATQQAPGGGEGGRPRPSWLASTLAFILIFTIVVDILGNLLVILSVYRNKK LRNSGNIFVVSLAVADLVVAVYPYPLVLTSILNNGWNLGYLHCQVSAFLMGLSVIGSIFN ITGIAMNRYCYICHSLKYDKIYSNKNSLCYVFLIWMLTLIAIMPNLQTGTLQYDPRIYSC TFTQSVSSAYTIAVVVFHFIVPMIIVIFCYLRIWVLVLQVRRRVKPDNKPKLKPQDFRNF VTMFVVFVLFAICWAPLNLIGLIVASDPATMVPRIPEWLFVASYYLAYFNSCLNAIIYGL LNQNFRKEYKKIIVSLCTAKMFFVESSNEEADKIKCKPSPLIPNNNLIKVDSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-(4-Chlorophenyl)glutaramic Acid
TRC-C378130-1G 1 g

3-(4-Chlorophenyl)glutaramic Acid

Sign In for Pricing
View Details
Recombinant Rat SHBG/ABP protein (His tag)
PDMR100090-01 20 µg

Recombinant Rat SHBG/ABP protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat SHBG/ABP protein (His tag)
PDMR100090-02 100 µg

Recombinant Rat SHBG/ABP protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat SHBG/ABP protein (His tag)
PDMR100090-03 500 µg

Recombinant Rat SHBG/ABP protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat SHBG/ABP protein (His tag)
PDMR100090-04 1 mg

Recombinant Rat SHBG/ABP protein (His tag)

Sign In for Pricing
View Details
Scarb1 Mouse Gene Knockout Kit (CRISPR)
KN515343 1 Kit

Scarb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details