Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 1 (Gpr1)

This Recombinant Mouse G-protein coupled receptor 1 (Gpr1) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

G-protein coupled receptor 1

UniProt

Q8K087

Expression Region

1-353

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVSKEMLFEELDNYSYALDYYSQESDPEEKVYLGLVHWISLFLYALAFVLGIPGNAIVI WLMGFKWKKTVTTLWFLNLAIADFIFVLFLPLYISYVALSFHWPFGLWLCKVNSFIAQLN MFSSVFFLTVISLDRYIHLLHPGLSHRHRTLKSSLVVVILVWLLASLLGGPTLYFRDTME VNNHIICYNNFQEHELTLMRHHVLTWVKFLFGYLFPLLTMSSCYLCLIFKMKKRNILISR KHLWMILSVVIAFLVCWTPYHLFSIWELSIHHNSSFQNVLQGGIPLSTGLAFLNSCLNPI LYVLISKTFQARFRASVAEVLKRSLWEASCSGTVSEQLRSAETKSLSLLETAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBR7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
49051066 1.0 µg DNA

UBR7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Phospho-RAD9 (Ser336) Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-5655R-APC-Cy5.5 100 µL

Phospho-RAD9 (Ser336) Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal STIM1 Antibody [Alexa Fluor 700]
NB110-60547AF700 0.1 mL

Rabbit Polyclonal STIM1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Brain Expressed X-Linked 5 (BEX5) Antibody (FITC)
abx307447-01 20 µg

Brain Expressed X-Linked 5 (BEX5) Antibody (FITC)

Sign In for Pricing
View Details
Brain Expressed X-Linked 5 (BEX5) Antibody (FITC)
abx307447-02 50 µg

Brain Expressed X-Linked 5 (BEX5) Antibody (FITC)

Sign In for Pricing
View Details
Brain Expressed X-Linked 5 (BEX5) Antibody (FITC)
abx307447-03 100 µg

Brain Expressed X-Linked 5 (BEX5) Antibody (FITC)

Sign In for Pricing
View Details