Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Melatonin receptor type 1A

This Recombinant Chicken Melatonin receptor type 1A spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Melatonin receptor type 1A, Mel-1A-R, Mel1a receptor, CKA

UniProt

P49285

Expression Region

1-353

Origin

Gallus gallus (Chicken)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRANGSELNGTVLPRDPPAEGSPRRPPWVTSTLATILIFTIVVDLLGNLLVILSVYRNKK LRNAGNIFVVSLAIADLVVAIYPYPLVLTSVFHNGWNLGYLHCQISGFLMGLSVIGSIFN ITGIAINRYCYICHSLKYDKLYSDKNSLCYVGLIWVLTVVAIVPNLFVGSLQYDPRIYSC TFAQSVSSAYTIAVVFFHFILPIAIVTYCYLRIWILVIQVRRRVKPDNNPRLKPHDFRNF VTMFVVFVLFAVCWAPLNFIGLAVAVDPETIIPRIPEWLFVSSYYMAYFNSCLNAIIYGL LNQNFRREYKKIVVSFCTAKAFFQDSSNDAADRIRSKPSPLITNNNQVKVDSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 (CCNB1) Mouse Monoclonal Antibody [Clone ID: 5G6]
AM06538SU-N 100 µL

Cyclin B1 (CCNB1) Mouse Monoclonal Antibody [Clone ID: 5G6]

Sign In for Pricing
View Details
Melanoma Marker (PNL2), CF640R conjugate, 0.1mg/mL
BNC400894-100 1x 100 µL

Melanoma Marker (PNL2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-PThrP
Y123164 100 µL

Anti-PThrP

Sign In for Pricing
View Details
ACAT2 (NM_001303253) Human Tagged ORF Clone
RG238154 10 µg

ACAT2 (NM_001303253) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lysyl tRNA synthetase (KARS) Human Gene Knockout Kit (CRISPR)
KN400311 1 Kit

Lysyl tRNA synthetase (KARS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IKZF3 (NM_012481) Human Over-expression Lysate
LC402225 20 µg

IKZF3 (NM_012481) Human Over-expression Lysate

Sign In for Pricing
View Details