Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Melatonin receptor type 1A

This Recombinant Chicken Melatonin receptor type 1A spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Melatonin receptor type 1A, Mel-1A-R, Mel1a receptor, CKA

UniProt

P49285

Expression Region

1-353

Origin

Gallus gallus (Chicken)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRANGSELNGTVLPRDPPAEGSPRRPPWVTSTLATILIFTIVVDLLGNLLVILSVYRNKK LRNAGNIFVVSLAIADLVVAIYPYPLVLTSVFHNGWNLGYLHCQISGFLMGLSVIGSIFN ITGIAINRYCYICHSLKYDKLYSDKNSLCYVGLIWVLTVVAIVPNLFVGSLQYDPRIYSC TFAQSVSSAYTIAVVFFHFILPIAIVTYCYLRIWILVIQVRRRVKPDNNPRLKPHDFRNF VTMFVVFVLFAVCWAPLNFIGLAVAVDPETIIPRIPEWLFVSSYYMAYFNSCLNAIIYGL LNQNFRREYKKIVVSFCTAKAFFQDSSNDAADRIRSKPSPLITNNNQVKVDSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DIPK2B Knockout A549 cell line
GTR15402927 1 Vial

Human DIPK2B Knockout A549 cell line

Sign In for Pricing
View Details
PAX7 (Paired Box 7, HUP1, PAX7B)
249763 100 µg

PAX7 (Paired Box 7, HUP1, PAX7B)

Sign In for Pricing
View Details
Lentiviral human BPIFB3 sgRNA gene knockout kit - Lentiviral human BPIFB3 sgRNA gene knockout kit (25)
GTR15371262 1 Vial

Lentiviral human BPIFB3 sgRNA gene knockout kit - Lentiviral human BPIFB3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
SMG1, CT (Serine/Threonine-protein Kinase SMG1, SMG-1, hSMG-1, Lambda/iota Protein Kinase C-interacting Protein, Lambda-interacting Protein, 61E3.4, ATX, KIAA0421, LIP) (APC)
MBS6499887-01 0.2 mL

SMG1, CT (Serine/Threonine-protein Kinase SMG1, SMG-1, hSMG-1, Lambda/iota Protein Kinase C-interacting Protein, Lambda-interacting Protein, 61E3.4, ATX, KIAA0421, LIP) (APC)

Sign In for Pricing
View Details
SMG1, CT (Serine/Threonine-protein Kinase SMG1, SMG-1, hSMG-1, Lambda/iota Protein Kinase C-interacting Protein, Lambda-interacting Protein, 61E3.4, ATX, KIAA0421, LIP) (APC)
MBS6499887-02 5x 0.2 mL

SMG1, CT (Serine/Threonine-protein Kinase SMG1, SMG-1, hSMG-1, Lambda/iota Protein Kinase C-interacting Protein, Lambda-interacting Protein, 61E3.4, ATX, KIAA0421, LIP) (APC)

Sign In for Pricing
View Details
CCNG2 Antibody
orb1267392 400 μl

CCNG2 Antibody

Sign In for Pricing
View Details