Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ambystoma tigrinum Rhodopsin (RHO)

This Recombinant Ambystoma tigrinum Rhodopsin (RHO) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

Q90245

Expression Region

1-354

Origin

Ambystoma tigrinum (Tiger salamander)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYVPFSNKSGVVRSPFEYPQYYLAEPWQYSVLAAYMFLLILLGFPVNFLTLY VTIQHKKLRTPLNYILLNLAFANHFMVFGGFPVTMYSSMHGYFVFGQTGCYIEGFFATMG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVMMTWIMALACAAPPLFGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFLVHFTIPLMIIFFCYGRLVCTVKEAAAQQQES ATTQKAEKEVTRMVIIMVVAFLICWVPYASVAFYIFSNQGTDFGPIFMTVPAFFAKSSAI YNPVIYIVLNKQFRNCMITTICCGKNPFGDDETTSAATSKTEASSVSSSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-100 1x 100 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-100 1x 100 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL
BNC040977-100 1x 100 µL

TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-500 1x 500 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details