Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Opsin-5 (OPN5)

This Recombinant Human Opsin-5 (OPN5) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Opsin-5, G-protein coupled receptor 136, G-protein coupled receptor PGR12, Neuropsin, Transmembrane protein 13

UniProt

Q6U736

Expression Region

1-354

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALNHTALPQDERLPHYLRDGDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSR RKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGS LITMTAVSLDRYLKICYLSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFG TSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRI HSSHVLEMKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAM YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CYP2W1 activation kit by CRISPRa
GA110360 1 Kit

Human CYP2W1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS713928 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
SIL1 (NM_022464) Human Over-expression Lysate
LC402924 20 µg

SIL1 (NM_022464) Human Over-expression Lysate

Sign In for Pricing
View Details
TFB2M (NM_022366) Human Over-expression Lysate
LC402922 20 µg

TFB2M (NM_022366) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09792P-01 20 Tests

PE/Elab Fluor® 594 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09792P-02 100 Tests

PE/Elab Fluor® 594 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details