Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Opsin-1, short-wave-sensitive 2 (opn1sw2)

This Recombinant Danio rerio Opsin-1, short-wave-sensitive 2 (opn1sw2) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Opsin-1, short-wave-sensitive 2, Blue cone photoreceptor pigment, Blue-sensitive opsin, Opsin SWS-2

UniProt

Q9W6A8

Expression Region

1-354

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQQQQTPELFEDFHMPITLDVSNISAYSPFLVPQDHLGHSGVFMGMSAFMLFLFIAGTA INVLTIVCTIQYKKLRSHLNYILVNLAISNLWVSVFGSSVAFYAFYKKYFVFGPIGCKIE GFTSTIGGMVSLWSLAVVALERWLVICKPLGNFTFKTPHAIAGCILPWCMALAAGLPPLL GWSRYIPEGLQCSCGPDWYTTNNKFNNESYVMFLFCFCFAVPFSTIVFCYGQLLITLKLA AKAQADSASTQKAEREVTKMVVVMVFGFLICWGPYAIFAIWVVSNRGAPFDLRLATIPSC LCKASTVYNPVIYVLMNKQFRSCMMKMVFNKNIEEDEASSSSQVTQVSSVAPEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-500 1x 500 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-500 1x 500 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-100 1x 100 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-100 1x 100 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (KIT/982), CF647 conjugate, 0.1mg/mL
BNC470982-500 1x 500 µL

CD117 (KIT/982), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF405S conjugate, 0.1mg/mL
BNC040035-100 1x 100 µL

Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details