Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C chemokine receptor type 7 (Ccr7)

This Recombinant Mouse C-C chemokine receptor type 7 (Ccr7) spans the amino acid sequence from region 25-378.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 7, C-C CKR-7, CC-CKR-7, CCR-7, Epstein-Barr virus-induced G-protein coupled receptor 1, EBI1

UniProt

P47774

Expression Region

25-378

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QDEVTDDYIGENTTVDYTLYESVCFKKDVRNFKAWFLPLMYSVICFVGLLGNGLVILTYI YFKRLKTMTDTYLLNLAVADILFLLILPFWAYSEAKSWIFGVYLCKGIFGIYKLSFFSGM LLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWMLALFLSIPELLYSGLQKNSG EDTLRCSLVSAQVEALITIQVAQMVFGFLVPMLAMSFCYLIIIRTLLQARNFERNKAIKV IIAVVVVFIVFQLPYNGVVLAQTVANFNITNSSCETSKQLNIAYDVTYSLASVRCCVNPF LYAFIGVKFRSDLFKLFKDLGCLSQERLRHWSSCRHVRNASVSMEAETTTTFSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ahsa1 Mouse Gene Knockout Kit (CRISPR)
KN501014 1 Kit

Ahsa1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Rat C4 protein (His tag)
PDER100196-01 20 µg

Recombinant Rat C4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat C4 protein (His tag)
PDER100196-02 100 µg

Recombinant Rat C4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat C4 protein (His tag)
PDER100196-03 500 µg

Recombinant Rat C4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat C4 protein (His tag)
PDER100196-04 1 mg

Recombinant Rat C4 protein (His tag)

Sign In for Pricing
View Details
Human ZNF514 activation kit by CRISPRa
GA113731 1 Kit

Human ZNF514 activation kit by CRISPRa

Sign In for Pricing
View Details