Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zeus faber Rhodopsin (rho)

This Recombinant Zeus faber Rhodopsin (rho) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O42604

Expression Region

1-354

Origin

Zeus faber (John Dory)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPDFYVPMVNTTGIVRSPYDYPQYYLVNPAAFSMLAAYMFFLILVGFPVNFLTLY VTMEHKKLRTPLNYILLNLAVANLFMVIGGFTTTMYTSMHGYFVLGRTGCNLEGFFATLG GEIALWSLVVLAVERWVVVCKPISNFRFGENHAVMGVSFTWLMACACSVPPLFGWSRYIP EGMQCSCGIDYYTRAPGYNNESFVIYMFVCHFSIPLTIIFFCYGRLLCAVKDAAAAQQES ETTQRAEREVSRMVVIMVIGFLICWLPYASVAWFIFTHQGSEFGPVFMTIPAFFAKSSAI YNPMIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSHVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-500 1x 500 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-500 1x 500 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF405S conjugate, 0.1mg/mL
BNC042145-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details