Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Galeus melastomus Rhodopsin (rho)

This Recombinant Galeus melastomus Rhodopsin (rho) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O93441

Expression Region

1-354

Origin

Galeus melastomus (Blackmouth catshark)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGENFYVPMSNKTGVVRNPFEYPQYYLADHWMFAVLAAYMFFLIITGFPVNFLTLF VTIQNKKLRQPLNYILLNLAVANLFMVFGGFTTTLITSMNGYFVFGSTGCNLEGFFATLG GEISLWSLVVLAIERYVVVCKPMSNFRFGSQHAIAGVSLTWVMAMACAAPPLVGWSRYIP EGLQCSCGIDYYTPKPEINNVSFVIYMFVVHFSIPLTIIFFCYGRLVCTVKAAAAQQQES ETTQRAEREVTRMVVIMVIGFLICWLPYASVALYIFNNQGSEFGPVFMTIPSFFAKSSAL YNPLIYILMNKQFRNCMITTLCCGKNPFEEEESTSASASKTEASSVSSSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-500 1x 500 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-100 1x 100 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL
BNC680421-100 1x 100 µL

Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF594 conjugate, 0.1mg/mL
BNC942266-100 1x 100 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details