Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gambusia affinis Rhodopsin (rho)

This Recombinant Gambusia affinis Rhodopsin (rho) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P79756

Expression Region

1-354

Origin

Gambusia affinis (Western mosquitofish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPYFYVPMVNTTGIVRSPYEYPQYYLVSPAAYACLGAYMFFLILVGFPVNFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVFGGFTTTIYTSMHGYFVLGRLGCNLEGYFATLG GEIGLWSLVVLAVERWLVVCKPISNFRFTENHAIMGLVFTWIMANACAAPPLLGWSRYIP EGMQCSCGVDYYTRAEGFNNESFVIYMFICHFCIPLVVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVVILVIGFLVCWTPYASVAWYIFSNQGSEFGPLFMTIPAFFAKSSSI YNPMIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-500 1x 500 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-500 1x 500 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-500 1x 500 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details