Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lithobates catesbeiana Rhodopsin (RHO)

This Recombinant Lithobates catesbeiana Rhodopsin (RHO) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P51470

Expression Region

1-354

Origin

Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYVPMSNKTGIVRSPFEYPQYYLAEPWKYSVLAAYMFLLILLGLPINFMTLY VTIQHKKLRTPLNYILLNLAFANHFMVLCGFTITMYTSLHGYFVFGQTGCYFEGFFATLG GEIALWSLVVLAIERYIVVCKPMSNFRFGENHAMMGVAFTWIMALACAVPPLFGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFVVHFLIPLIIISFCYGRLVCTVKEAAAQQQES ATTQKAEKEVTRMVVIMVIFFLICWVPYAYVAFYIFTHQGSEFGPIFMTVPAFFAKSSAI YNPVIYIMLNKQFRNCMITTLCCGKNPFGDEDASSAATSKTEATSVSTSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-500 1x 500 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-500 1x 500 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
BNC940158-500 1x 500 µL

Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF647 conjugate, 0.1mg/mL
BNC472341-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details