Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bufo bufo Rhodopsin (RHO)

This Recombinant Bufo bufo Rhodopsin (RHO) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P56514

Expression Region

1-354

Origin

Bufo bufo (European toad)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYIPMSNKTGVVRSPFEYPQYYLAEPWQYSILCAYMFLLILLGFPINFMTLY VTIQHKKLRTPLNYILLNLAFANHFMVLCGFTVTMYSSMNGYFILGATGCYVEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFSENHAVMGVAFTWIMALSCAVPPLLGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFVVHFTIPLIIIFFCYGRLVCTVKEAAAQQQES ATTQKAEKEVTRMVIIMVVFFLICWVPYASVAFFIFSNQGSEFGPIFMTVPAFFAKSSSI YNPVIYIMLNKQFRNCMITTLCCGKNPFGEDDASSAATSKTEASSVSSSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Coronin-1A (CORO1A) ELISA Kit
MBS7200634-01 48 Well

Rat Coronin-1A (CORO1A) ELISA Kit

Sign In for Pricing
View Details
Rat Coronin-1A (CORO1A) ELISA Kit
MBS7200634-02 96 Well

Rat Coronin-1A (CORO1A) ELISA Kit

Sign In for Pricing
View Details
Rat Coronin-1A (CORO1A) ELISA Kit
MBS7200634-03 5x 96 Well

Rat Coronin-1A (CORO1A) ELISA Kit

Sign In for Pricing
View Details
Rat Coronin-1A (CORO1A) ELISA Kit
MBS7200634-04 10x 96 Well

Rat Coronin-1A (CORO1A) ELISA Kit

Sign In for Pricing
View Details
KRT9, ID (K444) (Keratin, Type I Cytoskeletal 9, Cytokeratin-9, CK-9, Keratin-9, K9) (PE) discontinued
K0199-10W1-PE 200 µL

KRT9, ID (K444) (Keratin, Type I Cytoskeletal 9, Cytokeratin-9, CK-9, Keratin-9, K9) (PE) discontinued

Sign In for Pricing
View Details
ASB9 ORF Vector (Human) (pORF)
12519012 1.0 µg DNA

ASB9 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details