Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bufo marinus Rhodopsin (RHO)

This Recombinant Bufo marinus Rhodopsin (RHO) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

P56515

Expression Region

1-354

Origin

Bufo marinus (Giant toad) (Cane toad)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGPNFYIPMSNKTGVVRSPFEYPQYYLAEPWQYSVLCAYMFLLILLGFPINFMTLY VTIQHKKLRTPLNYILLNLAFANHFMVLCGFTVTMYSSMNGYFVFGQTGCYVEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFSENHAIMGVAFTWIMALACAAPPLFGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFVVHFLIPLIIIFFCYGRLVCTVKEAAAQQQES ATTQKAEKEVTRMVIIMVVFFLICWVPYASVAFFIFTHQGSEFGPVFMTIPAFFAKSSSI YNPVIYIMLNKQFRNCMITTLCCGKNPFGDEDASSAATSKTEASSVSSSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR10 Polyclonal Antibody APC Conjugated
C91240APC 100 µL

CCR10 Polyclonal Antibody APC Conjugated

Sign In for Pricing
View Details
MHC class II (Y-Ae) Alexa Fluor® 594
sc-32247 AF594 200 µg/mL

MHC class II (Y-Ae) Alexa Fluor® 594

Sign In for Pricing
View Details
Recombinant Geobacter sp. DNA mismatch repair protein mutL (mutL), partial
MBS1244408 Inquire

Recombinant Geobacter sp. DNA mismatch repair protein mutL (mutL), partial

Sign In for Pricing
View Details
Anti-Azurocidin/AZU1 Antibody Picoband
MBS1755432-01 0.01 mg

Anti-Azurocidin/AZU1 Antibody Picoband

Sign In for Pricing
View Details
Anti-Azurocidin/AZU1 Antibody Picoband
MBS1755432-02 0.1 mg (Carrier Free)

Anti-Azurocidin/AZU1 Antibody Picoband

Sign In for Pricing
View Details
Anti-Azurocidin/AZU1 Antibody Picoband
MBS1755432-03 0.1 mg

Anti-Azurocidin/AZU1 Antibody Picoband

Sign In for Pricing
View Details